Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ011978_1.cds

[Submit comment/correction]

Sequence	AJ011978_1.cds
Peptide	PHPNECSGSDLDGDIYFVSWDPDLIPTRMVAPMDYTPAPTETLDHDVMIE EVHEYFTNYIVNESLGIIANAHVVFADREILKAESTPCIKLAELFSIAVD FPKTGVP
Structure From Source	AJ011978
Source Exons	1 153 739 907
Corresponding Protein	AJ011978_1.protseq
Gene Product	RNA-directed RNA polymerase
Remark	DB_xref: GI:4138610 [ Show all 8 ]
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.