Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ131669_1.cds

[Submit comment/correction]

Sequence	AJ131669_1.cds
Peptide	GKSCYIRQVALITIMAQVGSFVPASSATLHVVDGIYTRMGASDSIQQGTS TFYEEMNEASSILQNCSSRSLVII
Structure From Source	AJ131669
Source Exons	1 223
Corresponding Protein	AJ131669_1.protseq
Gene Product	MSH3 protein
Remark	CDS note: MutS/hMSH3 homologous [ Show all 9 ]
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.