Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ131671_1.cds

[Submit comment/correction]

Sequence	AJ131671_1.cds
Peptide	GKSTFIRQVGVNVLMAQVGSFVPCDQASISVRDCIFARVGAGDCQLRGVS TFMQEMLETASILKGASEKSLIII
Structure From Source	AJ131671
Source Exons	1 223
Corresponding Protein	AJ131671_1.protseq
Gene Product	MSH2 protein
Remark	CDS note: MutS/hMSH2 homologous [ Show all 9 ]
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.