Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ222783_1.cds

[Submit comment/correction]

Sequence	AJ222783_1.cds
Peptide	GVKGDPTYLVVESDKTLATYGINAVCTHLGCVVPWNAAENKFLCPCHGSQ YNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG
Structure From Source	AJ222783
Source Exons	1 275
Corresponding Protein	AJ222783_1.protseq
Gene Product	cytochrome B6-F complex like-protein
Remark	CDS note: homology to cytochrome B6-F complex iron-sulfur protein subunit 2 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.