Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ222787_1.cds

Sequence	AJ222787_1.cds
Peptide	AALSAQDIVLPQYREPGVLLWRGFTLQEFANQLFGNNLDYGKGRQMPIHY GSNRLNLFTRSHRL
Structure From Source	AJ222787
Source Exons	1 193
Corresponding Protein	AJ222787_1.protseq
Gene Product	alpha-keto acid dehydrogenase-like protein
Remark	CDS note: homology to branched chain alpha-keto acid dehydrogenase E1-alpha subunit [ Show all 8 ]
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.