Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ238219_1.cds

[Submit comment/correction]

Sequence	AJ238219_1.cds
Peptide	NWKLYSERLMTLTGVYGFWKYVSNLERHETRRYLEMFYALKYRSLAAAVP
Structure From Source	AJ238219
Source Exons	1 134 229 247
Corresponding Protein	AJ238219_1.protseq
Gene Product	putative Sucrose synthase type 1
Remark	DB_xref: GI:6491853 Feature: CDS: protein_id = 'CAB61892.1'; Gene: ss1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.