Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ242715_1.cds

[Submit comment/correction]

Sequence	AJ242715_1.cds
Peptide	PVETKLNSCRNYLLDRCSTMKDFPVTWRWWKWWKGGCLELLGECCSQLGQ MPPQCRCNIIQGSIQGDLSGIFGFQRDRASKVIQEAKNLPPRCNQGPPCN IPGTIGYYW
Structure From Source	AJ242715
Source Exons	1 331
Corresponding Protein	AJ242715_1.protseq
Gene Product	puroindoline a
Remark	DB_xref: GI:30268562 [ Show all 6 ]
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.