Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ249932_1.cds

Sequence	AJ249932_1.cds
Peptide	MKALFLIGLLALVASTAFAQYSEVVGSYDVAGGGGAQQCPVETKLNSCRN YLLDRCSTMKDFPVTWRWWKWWKGGCQELLGECCSRLGQMPPQCRCNIIQ GSIQGDLGGIFGFQRDRASKVIQEAKNLPPRCNQGPPCNIPGTIGYYW
Structure From Source	AJ249932
Source Exons	1 447
Corresponding Protein	AJ249932_1.protseq
Gene	secaloa
Gene Product	secaloindoline-a
Remark	DB_xref: GI:7672276 [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.