Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ276143_2.cds

[Submit comment/correction]

Sequence	AJ276143_2.cds
Peptide	MKTLFLLALLALVASTTSAQYSVGGGYNDVGGGGGSQQCPQERPNLGSCK DYVMERCFTMKDFPVTWPTKWWKGGCEHEVREKCCQQLSQIAPHCRCDAI RGVIQGKLGGIFGIGGGAVFKQIQRAQILPSKCNMGVDCRFPSGYYW
Structure From Source	AJ276143
Source Exons	1 444
Corresponding Protein	AJ276143_2.protseq
Gene Product	hordoindoline-b
Remark	DB_xref: GI:8052264 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.