Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ291297_1.cds

[Submit comment/correction]

Sequence	AJ291297_1.cds
Peptide	TNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENEN VGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGKGA LSDH
Structure From Source	AJ291297
Source Exons	1 314
Corresponding Protein	AJ291297_1.protseq
Gene Product	F-1-ATPase alpha subunit
Remark	DB_xref: GI:10800834 Feature: CDS: protein_id = 'CAC12989.1'; Gene: atpA
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.