Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ302295_1.cds

[Submit comment/correction]

Sequence	AJ302295_1.cds
Peptide	MDIVTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKI GEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLRTG
Structure From Source	AJ302295
Source Exons	1 264
Corresponding Protein	AJ302295_1.protseq
Gene Product	MLA6-2 protein
Remark	CDS note: class C [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.