Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ310994_1.cds

Sequence	AJ310994_1.cds
Peptide	MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVY VLVV
Structure From Source	AJ310994
Source Exons	1 81 199 282
Corresponding Protein	AJ310994_1.protseq
Gene Product	putative membrane protein
Remark	DB_xref: GI:13751167 Feature: CDS: function = 'unknown'; protein_id = 'CAC37081.1'; Gene: lt101.1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.