Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ310995_1.cds

Sequence	AJ310995_1.cds
Peptide	MASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVY VLVA
Structure From Source	AJ310995
Source Exons	1 81 163 246
Corresponding Protein	AJ310995_1.protseq
Gene Product	putative membrane protein
Remark	DB_xref: GI:13751169 Feature: CDS: function = 'unknown'; protein_id = 'CAC37082.1'; Gene: lt101.2
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.