Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ413956_1.cds

[Submit comment/correction]

Sequence	AJ413956_1.cds
Peptide	VAFIDIIGRFWIQLMGFTMMTIFMLAIAIPYDYLVKPGHHTGFVVLYGLT
Structure From Source	AJ413956
Source Exons	1 150
Corresponding Protein	AJ413956_1.protseq
Gene Product	inorganic phosphate transporter
Remark	DB_xref: GI:15919097 Feature: CDS: protein_id = 'CAC88697.1'; Gene: PT
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.