Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ419771_1.cds

[Submit comment/correction]

Sequence	AJ419771_1.cds
Peptide	VWMEVEDQQYYPVISPVVFECIINPFIMGGAATNQKVVDKSLERLKGVLG MYE
Structure From Source	AJ419771
Source Exons	1 160
Corresponding Protein	AJ419771_1.protseq
Gene Product	putative glutathione-S-transferase
Remark	DB_xref: GI:21068492 [ Show all 7 ]
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.