Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ419772_1.cds

[Submit comment/correction]

Sequence	AJ419772_1.cds
Peptide	VWMEVDAHTYNPALSRSCTSASSTRSCAACRTNQTVVDESLEKLKKVLGI YE
Structure From Source	AJ419772
Source Exons	1 157
Corresponding Protein	AJ419772_1.protseq
Gene Product	putative glutathione-S-transferase
Remark	DB_xref: GI:21068494 [ Show all 7 ]
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.