Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ438315_1.cds

[Submit comment/correction]

Sequence	AJ438315_1.cds
Peptide	PNLKNLLHDLNSAAEVPQVTCVVADGVMSFSMDAVVELGV
Structure From Source	AJ438315
Source Exons	1 121
Corresponding Protein	AJ438315_1.protseq
Gene Product	glucosyltransferase
Remark	DB_xref: GI:23392905 Feature: CDS: protein_id = 'CAD27842.2'; ; On complementary strand. Gene: GbssI
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.