Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ555613_1.cds

[Submit comment/correction]

Sequence	AJ555613_1.cds
Peptide	MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLEVQETAENDDKCKCG TSCTCTNCTCGH
Structure From Source	AJ555613
Source Exons	1 189
Corresponding Protein	AJ555613_1.protseq
Gene Product	metallothionein-like protein type 3
Remark	DB_xref: GI:29786353 Feature: CDS: function = 'putative metal binding protein'; protein_id = 'CAD88266.1'; Gene: mt-3a
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.