Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ555615_1.cds

Sequence	AJ555615_1.cds
Peptide	MSCNCGSSCGCGSNCNCGKMYPDLEEKSGAIMQATAVILGVRPAKVRFEE VAESGEAGHGCSCGASCKCNPCNC
Structure From Source	AJ555615
Source Exons	1 222
Corresponding Protein	AJ555615_1.protseq
Gene Product	metallothionein-like protein
Remark	DB_xref: GI:29786357 Feature: CDS: function = 'putative metal-binding protein'; protein_id = 'CAD88268.1'; Gene: mt-1d
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.