Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ606017_1.cds

[Submit comment/correction]

Sequence	AJ606017_1.cds
Peptide	FGLARVAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGC IFAEILTGKPLFPGKNVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSS MRKKQPVCFSERFP
Structure From Source	AJ606017
Source Exons	1 341
Corresponding Protein	AJ606017_1.protseq
Gene Product	putative MAP kinase
Remark	DB_xref: GI:40641577 [ Show all 7 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.