Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ606027_1.cds

[Submit comment/correction]

Sequence	AJ606027_1.cds
Peptide	IAHPTVAVKVTSPYGNTVHHKENATVGQFAFTTSEAGNYLACFWLDSAEK GSGVSLNLDWKIGIATKDWDSVAKKEKIEGVELELAKLEAAVESIHHNLL YLKAREAEMREVSEKTNSRVAWFSILSLGDV
Structure From Source	AJ606027
Source Exons	1 394
Corresponding Protein	AJ606027_1.protseq
Gene Product	putative transmembrane protein-like protein
Remark	DB_xref: GI:40641597 [ Show all 8 ]
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.