Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ629309_1.cds

Sequence	AJ629309_1.cds
Peptide	RELQVASDNFNNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGEL QFQTEVEMISM
Structure From Source	AJ629309
Source Exons	1 183
Corresponding Protein	AJ629309_1.protseq
Gene	s5.8
Gene Product	receptor-like-kinase
Remark	DB_xref: GI:45095487 [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.