Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ704452_1.cds

[Submit comment/correction]

Sequence	AJ704452_1.cds
Peptide	LYNNIHHPSKLNVGADFHCFKDKIEPKWEDPICANGGKWTISCGKG
Structure From Source	AJ704452
Source Exons	1 139
Corresponding Protein	AJ704452_1.protseq
Gene Product	putative eukaryotic translation initiation factor 4E
Remark	DB_xref: GI:63024867 Feature: CDS: protein_id = 'CAG28664.1' Gene: eIF4E
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.