Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ852536_1.cds

[Submit comment/correction]

Sequence	AJ852536_1.cds
Peptide	MARAQVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQGGPGPS GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG VNLPYTISLNIDCSRV
Structure From Source	AJ852536
Source Exons	1 344 435 441
Corresponding Protein	AJ852536_1.protseq
Gene Product	type 1 non specific lipid transfer protein precursor
Remark	DB_xref: GI:84617183 Feature: CDS: protein_id = 'CAH69187.1' Gene: ltp9.1a
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.