Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AL356014_30.cds

[Submit comment/correction]

Sequence	AL356014_30.cds
Peptide	MVRVFLLYNLFNSFLLCLVPKKLRVFFPPSWYIDDKNPPPPDESETESPV DLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQMIQKMDANGD GCVDINEFESLYGSIVEEKEEGDMRDAFNVFDQDGDGFITVEELNSVMTS LGLKQGKTLECCKEMIMQVDEDGDGRVNYKEFLQMMKSGDFSNRS
Structure From Source	AL356014
Source Exons	1 588
Corresponding Protein	AL356014_30.protseq
Gene Product	calmodulin-like protein
Remark	CDS note: strong similarity to calcium-binding protein - Lotus japonicus, EMBL:AJ251808 Contains EF-hand calcium-binding domain AA60-72;EF-hand calcium-binding domain AA96-108;EF-hand calcium-binding domain AA132-144;EF-hand calcium-binding domain AA170-182 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.